PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_2597_iso_8
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB_related
Protein Properties Length: 88aa    MW: 10282.7 Da    PI: 9.8078
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_2597_iso_8genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding651.4e-201461148
                                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                        rg WT+eEd +l  +++q+G+++W++I+++ g+ R++k+c++rw +yl
  cra_locus_2597_iso_8_len_792_ver_3 14 RGQWTPEEDHKLTSYIAQHGTRNWRLIPKHAGLQRCGKSCRLRWTNYL 61
                                        89********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.3E-27564IPR009057Homeodomain-like
PROSITE profilePS5129426.781965IPR017930Myb domain
SMARTSM007171.8E-131363IPR001005SANT/Myb domain
PfamPF002495.6E-191461IPR001005SANT/Myb domain
SuperFamilySSF466895.01E-231588IPR009057Homeodomain-like
CDDcd001671.32E-111761No hitNo description
Gene3DG3DSA:1.10.10.609.4E-76588IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 88 aa     Download sequence    Send to blast
MGRIPCCEKE NVKRGQWTPE EDHKLTSYIA QHGTRNWRLI PKHAGLQRCG KSCRLRWTNY  60
LRPDLKHGQF SDAEEQTIVT LHSVLGNR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-171188480B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004248353.19e-59PREDICTED: protein ODORANT1
SwissprotQ9XHV05e-56MYB80_ARATH; Transcription factor MYB80
TrEMBLA0A068UZI43e-59A0A068UZI4_COFCA; Uncharacterized protein
STRINGSolyc10g005760.1.13e-58(Solanum lycopersicum)